PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g33100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 181aa    MW: 20268.1 Da    PI: 10.4227
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g33100genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA88.87.4e-281165258
   CBFB_NFYA  2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                 p++VNaKQy++Il+RR++Rak  e kk   k rkpylh SRh hAlrRpRg+gGrF
  CA00g33100 11 GPIFVNAKQYHGILRRRKSRAKEME-KKA-LKPRKPYLHLSRHLHALRRPRGCGGRF 65
                69*******************9666.555.6*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.4E-30868IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115231.492968IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.2E-231265IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.7E-211234IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.7E-214265IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MLPLNLASDE GPIFVNAKQY HGILRRRKSR AKEMEKKALK PRKPYLHLSR HLHALRRPRG  60
CGGRFLNTRN MNGTMKDGKT NDTFRASDVQ NFYPTGSQNS EVLQSDSSNL SSPKETINSR  120
FYESSGVTNM YSSGNLDPFP FQNLRPLQVQ AIPDMMNTGL GILMTDKWVG TADSCCNLKV  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A1e-161068262HAPB protein
4g91_A1e-161068262HAPB protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016546107.11e-132PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1
TrEMBLM1BXA51e-114M1BXA5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000550611e-114(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37062347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34720.12e-20nuclear factor Y, subunit A4